PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca22315.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family TALE
Protein Properties Length: 706aa    MW: 76796.7 Da    PI: 7.0964
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca22315.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.21.6e-093613981954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Dca22315.1 361 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 398
                 554459******************************88 PP

2BELL116.71.1e-37218289172
        BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 +r+elq+kkakLl++l+eVd+rY+qy+ q+q+++ssFe++ag+gsak+YtslAlk+iS++Fr Lkdai++qi
  Dca22315.1 218 QRHELQMKKAKLLNMLDEVDQRYRQYNTQMQIIASSFEQAAGIGSAKSYTSLALKTISKQFRTLKDAISSQI 289
                 699********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.8E-56135287IPR006563POX domain
PfamPF075264.3E-46143286IPR006563POX domain
PROSITE profilePS5007112.131339402IPR001356Homeobox domain
SMARTSM003892.3E-9342406IPR001356Homeobox domain
CDDcd000861.81E-12342403No hitNo description
SuperFamilySSF466895.13E-17343410IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.7E-29345408IPR009057Homeodomain-like
PfamPF059202.9E-18359398IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 706 aa     Download sequence    Send to blast
MLNPTVTPNT LTHGIIPQHH HPQLVGIPLA GPHHHSASGA DLSRADLSRT SLHHHNHHLN  60
QMASAINGLV GPRAHYANTG LWSPASETGP AQSGPIQDFP GQAQGQARGG LSLSLSPGLQ  120
RARAEGDDGR MSVTLAGPGP MVGSKYLKAA QELLEEVVNV ADNNNNVGGG DHNNNNNNNM  180
ESSKGKAVVE EGGGDDDVAG GGDGGESSKK GGELSMAQRH ELQMKKAKLL NMLDEVDQRY  240
RQYNTQMQII ASSFEQAAGI GSAKSYTSLA LKTISKQFRT LKDAISSQIK AANKSLGEEN  300
IVGVKLEGGG GVGSRLRLVD QQISQHRALQ QLGMMQPSHN AWRPQRGLPE RAVSVLRAWL  360
FEHFLHPYPK DSDKHMLAKQ TGLTRSQVSN WFINARVRLW KPMVEEMYVE EMKSHEQNNI  420
VPTDDTTTTT TTNNGGEIGG SSSKNERNQD LSTTNKTIII TQQQHQQPQQ QGDLGFDNNQ  480
QTTNDMISSL STMSTTSPQG FTLIGSSSDM ETLMARSQKK HRSNNNNNSD MNSPSSILSM  540
DMEMKPIDHQ QQQQQPKYGQ YSSSMTSIHG GTGYNNPYIM NNNHNNIGRL FSHNQLTTAS  600
YHGNAVALTL GLPHCDNSNN NNNNNGNNIS LSENHHQQNF FPSNHQGMDL GRRVEIGANE  660
GDFCGSNIGG GGGHETSHPS NNVVYESIDI QSRKRFAAQI LHDFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-16348406563Homeobox protein Meis2
3k2a_B1e-16348406563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010685441.10.0PREDICTED: BEL1-like homeodomain protein 1
TrEMBLA0A0J8BY690.0A0A0J8BY69_BETVU; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.32e-89BEL1-like homeodomain 1